PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_004410-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family bHLH
Protein Properties Length: 408aa    MW: 46688.8 Da    PI: 8.5664
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_004410-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH185.2e-061361654
                   HHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
            HLH  6 nerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                   + +Er+RR +++   ++L  l+Pk  + +    +  + L +A  YI +L
  NNU_004410-RA 13 KTIERNRRIHMKRLCFKLDALIPKHQNVYRDATNQRDRLDRAASYIMQL 61
                   679*********************65667777999999********998 PP

2HLH21.34.7e-07233285555
                    HHHHHHHHHHHHHHHHHHHHCTSCCC......TTS-STCHHHHHHHHHHHHHHH CS
            HLH   5 hnerErrRRdriNsafeeLrellPkas...kapskKlsKaeiLekAveYIksLq 55 
                     +++Er+RR +++   ++L +l+ k     k  s   +K + L +A+ YIk+L+
  NNU_004410-RA 233 RKIIERNRRIHMKGLCFKLASLIAKHHnasKDASSEGDKLD-LDHAISYIKQLR 285
                    579**********************6658844444455555.9*********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508888.55761IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474597.07E-81176IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.2E-71273IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003530.261367IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.81E-5226289No hitNo description
SuperFamilySSF474592.36E-7228297IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS508888.74228284IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.5E-7232293IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.4E-6234290IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MNTCGGSTKP DRKTIERNRR IHMKRLCFKL DALIPKHQNV YRDATNQRDR LDRAASYIMQ  60
LRERIEELKE RRQLVMCIKG INRNMRDSMK IDDVGLPVLE LRDSGPNLEV VLISGLNKSF  120
TFYEIICVLE EEGAEVVNAS FACVGDRIFH TIHAQVKCSR VGIETSTVSE RLKEVVHSMN  180
PTSFASADTE SPGFSRLLPF LPQSETLRGQ NLEEQKQEEM KQRRRSESAK LDRKIIERNR  240
RIHMKGLCFK LASLIAKHHN ASKDASSEGD KLDLDHAISY IKQLRERVEE LKGRKQFTMS  300
IKGINTDFRD TMKIEFTLPI LELRDLGPNL EVLLVSGFDK NFLFYEVISL LEEEGAEVVN  360
ASFSCIGDKI FHTIHAQVTS SGVGMEISRV RERLKDLVLS MLSTSFIN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251286.11e-134PREDICTED: uncharacterized protein LOC104593221 isoform X2
TrEMBLD7SHT71e-65D7SHT7_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g08150.t014e-65(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.15e-23bHLH family protein